Lineage for d1t1lb_ (1t1l B:)
- Root: SCOP 1.69
Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
not a true fold, gathers together transmembrane barrels of different (n,S)
Superfamily f.4.3: Porins [56935] (4 families) 
Family f.4.3.4: Outer membrane protein transport protein (Pfam 03349) [111361] (1 protein)
monomeric (14,16) barrel; plugged by an N-terminal all-alpha subdomain (1-40)Protein Long-chain fatty acid transport protein FadL [111362] (1 species) Species Escherichia coli [TaxId:562] [111363] (2 PDB entries) 
Domain d1t1lb_: 1t1l B: [106253]
Details for d1t1lb_
PDB Entry: 1t1l (more details), 2.8 Å
PDB Description: Crystal structure of the long-chain fatty acid transporter FadL
SCOP Domain Sequences for d1t1lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1lb_ f.4.3.4 (B:) Long-chain fatty acid transport protein FadL {Escherichia coli}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
f
SCOP Domain Coordinates for d1t1lb_:
Click to download the PDB-style file with coordinates for d1t1lb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t1lb_:
- d1t1lb_ is new in SCOP 1.69
- d1t1lb_ appears in SCOP 1.71
- d1t1lb_ appears in the current release, SCOPe 2.08
View in 3D
