Lineage for d1t1la_ (1t1l A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627873Family f.4.3.4: Outer membrane protein transport protein [111361] (2 proteins)
    Pfam PF03349; monomeric (14,16) barrel; plugged by an N-terminal all-alpha subdomain (1-40)
  6. 2627874Protein Long-chain fatty acid transport protein FadL [111362] (1 species)
  7. 2627875Species Escherichia coli [TaxId:562] [111363] (2 PDB entries)
    Uniprot P10384
  8. 2627878Domain d1t1la_: 1t1l A: [106252]
    complexed with lda

Details for d1t1la_

PDB Entry: 1t1l (more details), 2.8 Å

PDB Description: Crystal structure of the long-chain fatty acid transporter FadL
PDB Compounds: (A:) Long-chain fatty acid transport protein

SCOPe Domain Sequences for d1t1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1la_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
f

SCOPe Domain Coordinates for d1t1la_:

Click to download the PDB-style file with coordinates for d1t1la_.
(The format of our PDB-style files is described here.)

Timeline for d1t1la_: