Lineage for d1t1jb_ (1t1j B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496737Fold c.137: Hypothetical protein PA1492 [110459] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 496738Superfamily c.137.1: Hypothetical protein PA1492 [110460] (1 family) (S)
  5. 496739Family c.137.1.1: Hypothetical protein PA1492 [110461] (1 protein)
  6. 496740Protein Hypothetical protein PA1492 [110462] (1 species)
  7. 496741Species Pseudomonas aeruginosa [TaxId:287] [110463] (1 PDB entry)
  8. 496743Domain d1t1jb_: 1t1j B: [106250]
    Structural genomics target

Details for d1t1jb_

PDB Entry: 1t1j (more details), 1.7 Å

PDB Description: Crystal structure of genomics APC5043

SCOP Domain Sequences for d1t1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1jb_ c.137.1.1 (B:) Hypothetical protein PA1492 {Pseudomonas aeruginosa}
nlyfqghmrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlcl
aeldraaigrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsev
ehefr

SCOP Domain Coordinates for d1t1jb_:

Click to download the PDB-style file with coordinates for d1t1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1t1jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t1ja_