SCOPe 2.08: Domain d1t1jb1: 1t1j B:1-118

Lineage for d1t1jb1 (1t1j B:1-118)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.2: Hypothetical protein PA1492 [110461] (1 protein)
   lacks the last strand; monomer; predicted deoxyribosyltransferase activity
   automatically mapped to Pfam PF09152

6. Protein Hypothetical protein PA1492 [110462] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110463] (1 PDB entry)
   Uniprot Q9I3M0

8. Domain d1t1jb1: 1t1j B:1-118 [106250]
   Other proteins in same PDB: d1t1ja2, d1t1jb2
   Structural genomics target

Details for d1t1jb1

PDB Entry: 1t1j, 1.7 Å

PDB Description: Crystal structure of genomics APC5043

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1t1jb1:

Sequence; same for both SEQRES and ATOM records:

>d1t1jb1 c.23.14.2 (B:1-118) Hypothetical protein PA1492 {Pseudomonas aeruginosa [TaxId: 287]}
mrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlclaeldraa
igrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsevehefr

Timeline for d1t1jb1:

• d1t1jb1 first appeared in SCOP 1.69, called d1t1jb_
  
• d1t1jb1 appears in SCOPe 2.07