![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.2: Hypothetical protein PA1492 [110461] (1 protein) lacks the last strand; monomer; predicted deoxyribosyltransferase activity automatically mapped to Pfam PF09152 |
![]() | Protein Hypothetical protein PA1492 [110462] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110463] (1 PDB entry) Uniprot Q9I3M0 |
![]() | Domain d1t1ja1: 1t1j A:1-118 [106249] Other proteins in same PDB: d1t1ja2, d1t1jb2 Structural genomics target |
PDB Entry: 1t1j (more details), 1.7 Å
SCOPe Domain Sequences for d1t1ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1ja1 c.23.14.2 (A:1-118) Hypothetical protein PA1492 {Pseudomonas aeruginosa [TaxId: 287]} mrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlclaeldraa igrlwapvdafymdhleelivldlpgwrdsagirremeffeaggqrvslwsevehefr
Timeline for d1t1ja1: