Lineage for d1t1ia_ (1t1i A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 485773Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 485774Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 485911Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (1 protein)
    elaborated with additional structures
  6. 485912Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 485919Species Bacillus novosp., mn-32, kumamolisin [75226] (7 PDB entries)
  8. 485922Domain d1t1ia_: 1t1i A: [106248]

Details for d1t1ia_

PDB Entry: 1t1i (more details), 1.28 Å

PDB Description: High Resolution Crystal Structure of Mutant W129A of Kumamolisin, a Sedolisin Type Proteinase (previously called Kumamolysin or KSCP)

SCOP Domain Sequences for d1t1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1ia_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp., mn-32, kumamolisin}
aaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvs
vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
kpsivsisaggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp

SCOP Domain Coordinates for d1t1ia_:

Click to download the PDB-style file with coordinates for d1t1ia_.
(The format of our PDB-style files is described here.)

Timeline for d1t1ia_: