Lineage for d1t1ga_ (1t1g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873793Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
    elaborated with additional structures
  6. 2873794Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 2873801Species Bacillus novosp. MN-32, kumamolisin [TaxId:198803] [75226] (7 PDB entries)
    Uniprot Q8RR56 ! Uniprot Q8RR56
  8. 2873802Domain d1t1ga_: 1t1g A: [106246]
    complexed with ca, so4; mutant

Details for d1t1ga_

PDB Entry: 1t1g (more details), 1.18 Å

PDB Description: high resolution crystal structure of mutant e23a of kumamolisin, a sedolisin type proteinase (previously called kumamolysin or kscp)
PDB Compounds: (A:) kumamolisin

SCOPe Domain Sequences for d1t1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}
aaptaytpldvaqayqfpegldgqgqciaiialgggydetslaqyfaslgvsapqvvsvs
vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
kpsivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp

SCOPe Domain Coordinates for d1t1ga_:

Click to download the PDB-style file with coordinates for d1t1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1t1ga_: