Lineage for d1t11b2 (1t11 B:1-129)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240771Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
    beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e
  4. 2240783Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families) (S)
    automatically mapped to Pfam PF05697
  5. 2240784Family d.241.2.1: Trigger factor ribosome-binding domain [102736] (1 protein)
  6. 2240785Protein Trigger factor ribosome-binding domain [102737] (2 species)
  7. 2240795Species Vibrio cholerae [TaxId:666] [110787] (1 PDB entry)
    Uniprot Q9KQS5
  8. 2240797Domain d1t11b2: 1t11 B:1-129 [106240]
    Other proteins in same PDB: d1t11a1, d1t11a3, d1t11a4, d1t11b1, d1t11b3, d1t11b4

Details for d1t11b2

PDB Entry: 1t11 (more details), 2.5 Å

PDB Description: trigger factor
PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d1t11b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t11b2 d.241.2.1 (B:1-129) Trigger factor ribosome-binding domain {Vibrio cholerae [TaxId: 666]}
mqvtvetleglqrrlnitvpaaniedavaaelrniaknrrfdgfrkgkvpmkmvakmygk
avrqdvlgevmqrhfieaivkekinpagaptfapveigegkdlvftatfevypevelkgl
eniavekpa

SCOPe Domain Coordinates for d1t11b2:

Click to download the PDB-style file with coordinates for d1t11b2.
(The format of our PDB-style files is described here.)

Timeline for d1t11b2: