Class a: All alpha proteins [46456] (290 folds) |
Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
Family a.223.1.1: TF C-terminus [109999] (1 protein) Pfam PF05698; includes the upstream linker region not covered by the Pfam model |
Protein Trigger factor, C-terminal domain [110000] (2 species) |
Species Vibrio cholerae [TaxId:666] [110002] (1 PDB entry) Uniprot Q9KQS5 |
Domain d1t11b1: 1t11 B:248-376 [106239] Other proteins in same PDB: d1t11a2, d1t11a3, d1t11a4, d1t11b2, d1t11b3, d1t11b4 |
PDB Entry: 1t11 (more details), 2.5 Å
SCOPe Domain Sequences for d1t11b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t11b1 a.223.1.1 (B:248-376) Trigger factor, C-terminal domain {Vibrio cholerae [TaxId: 666]} lndefvarfgvaeggvdalkaevrknmerelkqaikarikeqaieglvkeneiqvpsali dqeinvlrqqaaqrfggnveaaaqlprelfeeqakrrvvvglllgevirthelkadeekv kalitemat
Timeline for d1t11b1:
View in 3D Domains from other chains: (mouse over for more information) d1t11a1, d1t11a2, d1t11a3, d1t11a4 |