SCOP 1.71: Domain d1t11a1: 1t11 A:248-376

Lineage for d1t11a1 (1t11 A:248-376)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.1: TF C-terminus [109999] (1 protein)
   Pfam 05698; includes the upstream linker region not covered by the Pfam model

6. Protein Trigger factor, C-terminal domain [110000] (2 species)

7. Species Vibrio cholerae [TaxId:666] [110002] (1 PDB entry)

8. Domain d1t11a1: 1t11 A:248-376 [106236]
   Other proteins in same PDB: d1t11a2, d1t11a3, d1t11b2, d1t11b3

Details for d1t11a1

PDB Entry: 1t11, 2.5 Å

PDB Description: trigger factor

SCOP Domain Sequences for d1t11a1:

Sequence; same for both SEQRES and ATOM records:

>d1t11a1 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain {Vibrio cholerae}
lndefvarfgvaeggvdalkaevrknmerelkqaikarikeqaieglvkeneiqvpsali
dqeinvlrqqaaqrfggnveaaaqlprelfeeqakrrvvvglllgevirthelkadeekv
kalitemat

Timeline for d1t11a1:

• d1t11a1 first appeared in SCOP 1.69
  
• d1t11a1 appears in SCOP 1.73
  
• d1t11a1 appears in the current release, SCOPe 2.08