![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
![]() | Family a.223.1.1: TF C-terminus [109999] (1 protein) Pfam 05698; includes the upstream linker region not covered by the Pfam model |
![]() | Protein Trigger factor, C-terminal domain [110000] (2 species) |
![]() | Species Vibrio cholerae [TaxId:666] [110002] (1 PDB entry) |
![]() | Domain d1t11a1: 1t11 A:248-376 [106236] Other proteins in same PDB: d1t11a2, d1t11a3, d1t11b2, d1t11b3 |
PDB Entry: 1t11 (more details), 2.5 Å
SCOP Domain Sequences for d1t11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t11a1 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain {Vibrio cholerae} lndefvarfgvaeggvdalkaevrknmerelkqaikarikeqaieglvkeneiqvpsali dqeinvlrqqaaqrfggnveaaaqlprelfeeqakrrvvvglllgevirthelkadeekv kalitemat
Timeline for d1t11a1: