Lineage for d1t10a_ (1t10 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493569Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 493570Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 493589Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (1 protein)
    permutation of the double-SIS domain fold
  6. 493590Protein Phosphoglucose isomerase, PGI [53702] (5 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 493611Species Leishmania mexicana [TaxId:5665] [110728] (2 PDB entries)
  8. 493612Domain d1t10a_: 1t10 A: [106235]

Details for d1t10a_

PDB Entry: 1t10 (more details), 2.35 Å

PDB Description: phosphoglucose isomerase from leishmania mexicana in complex with substrate d-fructose-6-phosphate

SCOP Domain Sequences for d1t10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t10a_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Leishmania mexicana}
sllnlpawkrlqslyekygndsilshfekdhqrfqrysieidlhsddnflfldyskshin
deikdalvalaeergvrafakamfdgqrvnstenravlhvalrnrsnrpiivdgkdvmsd
vnnvlaqmkdftervrsgewkgqtgksiynivnigiggsdlgpvmvtealkpfskrdlhc
ffvsnvdgthmaevlkqvnleetifiiasktfttqetltnamsarnalmsylkengistd
gavakhfvalstntekvrefgidtvnmfafwdwvggrysvwsaiglsvmlsigydnfvef
ltgahvmdnhfastpteqnlpmmlalvgiwynnffgsetqavlpydqylwrlpaylqqld
mesngkgvtkksgavavqtgpivfgeagtngqhafyqlihqgtkiipcdfigcvqtqnrv
gdhhrtlmsnffaqtealmvgknaeevrqelvksgmsgdaienmiphktftgsrpsnsil
vnaltpralgaiiamyehkvlvqgaiwginsydqwgvelgkvlaksilpqlksgnivsdh
dgstnglinmfntrah

SCOP Domain Coordinates for d1t10a_:

Click to download the PDB-style file with coordinates for d1t10a_.
(The format of our PDB-style files is described here.)

Timeline for d1t10a_: