Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.10: Chlorite dismutase-like [110965] (2 proteins) Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer |
Protein YwfI homologue [110966] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [110967] (1 PDB entry) Uniprot Q5KUD5 # 98% sequence identity; Geobacillus kaustophilus TaxID:1462 |
Domain d1t0ty_: 1t0t Y: [106232] complexed with mg, p33 |
PDB Entry: 1t0t (more details), 1.75 Å
SCOPe Domain Sequences for d1t0ty_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ty_ d.58.4.10 (Y:) YwfI homologue {Bacillus stearothermophilus [TaxId: 1422]} qtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavytivg qkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedpyqip evrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqi itgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssf fhv
Timeline for d1t0ty_:
View in 3D Domains from other chains: (mouse over for more information) d1t0tv_, d1t0tw_, d1t0tx_, d1t0tz_ |