SCOP 1.73: Domain d1t0sc_: 1t0s C:

Lineage for d1t0sc_ (1t0s C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (1 family)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [110817] (5 PDB entries)

8. Domain d1t0sc_: 1t0s C: [106228]
   Other proteins in same PDB: d1t0sa_, d1t0sb_
   complexed with bml, fe, mcr, oh

Details for d1t0sc_

PDB Entry: 1t0s, 2.2 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase with 4-bromophenol bound

PDB Compounds: (C:) touB

SCOP Domain Sequences for d1t0sc_:

Sequence; same for both SEQRES and ATOM records:

>d1t0sc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d1t0sc_:

• d1t0sc_ first appeared in SCOP 1.69
  
• d1t0sc_ appears in SCOP 1.71
  
• d1t0sc_ appears in SCOP 1.75
  
• d1t0sc_ appears in the current release, SCOPe 2.08