![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.12: TmoB-like [110814] (1 family) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.12.1: TmoB-like [110815] (1 protein) Pfam 06234 |
![]() | Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species) |
![]() | Species Pseudomonas stutzeri [TaxId:316] [110817] (3 PDB entries) |
![]() | Domain d1t0sc_: 1t0s C: [106228] Other proteins in same PDB: d1t0sa_, d1t0sb_ complexed with bml, fe, mcr, oh |
PDB Entry: 1t0s (more details), 2.2 Å
SCOP Domain Sequences for d1t0sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0sc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri} tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf prgmivsdaglrptetldiifmd
Timeline for d1t0sc_: