SCOPe 2.05: Domain d1t0qc_: 1t0q C:

Lineage for d1t0qc_ (1t0q C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
   Uniprot O87799

8. Domain d1t0qc_: 1t0q C: [106222]
   Other proteins in same PDB: d1t0qa_, d1t0qb_
   complexed with fe, mcr, oh, so4

Details for d1t0qc_

PDB Entry: 1t0q, 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase

PDB Compounds: (C:) touB

SCOPe Domain Sequences for d1t0qc_:

Sequence; same for both SEQRES and ATOM records:

>d1t0qc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d1t0qc_:

• d1t0qc_ first appeared in SCOP 1.69
  
• d1t0qc_ appears in SCOPe 2.04
  
• d1t0qc_ appears in SCOPe 2.06
  
• d1t0qc_ appears in the current release, SCOPe 2.08