Lineage for d1t0qc_ (1t0q C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718290Superfamily d.15.12: TmoB-like [110814] (1 family) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 718291Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 718292Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)
  7. 718293Species Pseudomonas stutzeri [TaxId:316] [110817] (5 PDB entries)
  8. 718295Domain d1t0qc_: 1t0q C: [106222]
    Other proteins in same PDB: d1t0qa_, d1t0qb_
    complexed with fe, mcr, oh, so4

Details for d1t0qc_

PDB Entry: 1t0q (more details), 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase
PDB Compounds: (C:) touB

SCOP Domain Sequences for d1t0qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0qc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOP Domain Coordinates for d1t0qc_:

Click to download the PDB-style file with coordinates for d1t0qc_.
(The format of our PDB-style files is described here.)

Timeline for d1t0qc_: