Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (1 family) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.1: TmoB-like [110815] (1 protein) Pfam PF06234 |
Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species) |
Species Pseudomonas stutzeri [TaxId:316] [110817] (5 PDB entries) |
Domain d1t0qc_: 1t0q C: [106222] Other proteins in same PDB: d1t0qa_, d1t0qb_ complexed with fe, mcr, oh, so4 |
PDB Entry: 1t0q (more details), 2.15 Å
SCOP Domain Sequences for d1t0qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0qc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]} tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf prgmivsdaglrptetldiifmd
Timeline for d1t0qc_: