Lineage for d1t0qb_ (1t0q B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265471Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1265744Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 1265756Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
    Uniprot O87802
  8. 1265758Domain d1t0qb_: 1t0q B: [106221]
    Other proteins in same PDB: d1t0qa_, d1t0qc_
    complexed with fe, mcr, oh, so4

Details for d1t0qb_

PDB Entry: 1t0q (more details), 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase
PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d1t0qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0qb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d1t0qb_:

Click to download the PDB-style file with coordinates for d1t0qb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0qb_: