SCOP 1.73: Domain d1t0qb_: 1t0q B:

Lineage for d1t0qb_ (1t0q B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (5 PDB entries)

8. Domain d1t0qb_: 1t0q B: [106221]
   Other proteins in same PDB: d1t0qa_, d1t0qc_
   complexed with fe, mcr, oh, so4

Details for d1t0qb_

PDB Entry: 1t0q, 2.15 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOP Domain Sequences for d1t0qb_:

Sequence; same for both SEQRES and ATOM records:

>d1t0qb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d1t0qb_:

• d1t0qb_ first appeared in SCOP 1.69
  
• d1t0qb_ appears in SCOP 1.71
  
• d1t0qb_ appears in SCOP 1.75
  
• d1t0qb_ appears in the current release, SCOPe 2.08