Lineage for d1t0lb_ (1t0l B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386178Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 1386179Species Human (Homo sapiens) [TaxId:9606] [110715] (2 PDB entries)
    Uniprot O75874
  8. 1386181Domain d1t0lb_: 1t0l B: [106217]
    complexed with ca, ict, nap

Details for d1t0lb_

PDB Entry: 1t0l (more details), 2.41 Å

PDB Description: Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex with NADP, isocitrate, and calcium(2+)
PDB Compounds: (B:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d1t0lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0lb_ c.77.1.1 (B:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d1t0lb_:

Click to download the PDB-style file with coordinates for d1t0lb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0lb_: