SCOPe 2.01: Domain d1t0kb_: 1t0k B:

Lineage for d1t0kb_ (1t0k B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (4 PDB entries)
   Uniprot P14120

8. Domain d1t0kb_: 1t0k B: [106215]
   Other proteins in same PDB: d1t0ka_
   protein/RNA complex; complexed with mtt

Details for d1t0kb_

PDB Entry: 1t0k, 3.24 Å

PDB Description: joint x-ray and nmr refinement of yeast l30e-mrna complex

PDB Compounds: (B:) 60s ribosomal protein l30

SCOPe Domain Sequences for d1t0kb_:

Sequence; same for both SEQRES and ATOM records:

>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyamlsktkvy
yfqggnnelgtavgklfrvgvvsileagdsdilttla

Timeline for d1t0kb_:

• d1t0kb_ first appeared in SCOP 1.69
  
• d1t0kb_ appears in SCOP 1.75
  
• d1t0kb_ appears in SCOPe 2.02
  
• d1t0kb_ appears in the current release, SCOPe 2.08