![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (4 PDB entries) Uniprot P14120 |
![]() | Domain d1t0kb_: 1t0k B: [106215] Other proteins in same PDB: d1t0ka_ complexed with mtt |
PDB Entry: 1t0k (more details), 3.24 Å
SCOP Domain Sequences for d1t0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyamlsktkvy yfqggnnelgtavgklfrvgvvsileagdsdilttla
Timeline for d1t0kb_: