Lineage for d1t0jb_ (1t0j B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829578Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 829579Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries)
    Uniprot P54288 234-451
  8. 829581Domain d1t0jb_: 1t0j B: [106212]
    Other proteins in same PDB: d1t0ja_, d1t0jc_
    complexed with cl

Details for d1t0jb_

PDB Entry: 1t0j (more details), 2 Å

PDB Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
PDB Compounds: (B:) voltage-gated calcium channel subunit beta2a

SCOP Domain Sequences for d1t0jb_:

Sequence, based on SEQRES records: (download)

>d1t0jb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
fkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadi
slakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaqls
ktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqesfdvilden
qledacehladyleaywkathppssnlpnpllsrt

Sequence, based on observed residues (ATOM records): (download)

>d1t0jb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislaka
iiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvkiss
pkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywkath
ppssnrt

SCOP Domain Coordinates for d1t0jb_:

Click to download the PDB-style file with coordinates for d1t0jb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0jb_: