SCOP 1.71: Domain d1t0jb_: 1t0j B:

Lineage for d1t0jb_ (1t0j B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries)

8. Domain d1t0jb_: 1t0j B: [106212]
   Other proteins in same PDB: d1t0ja_, d1t0jc_
   complexed with cl

Details for d1t0jb_

PDB Entry: 1t0j, 2 Å

PDB Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit

SCOP Domain Sequences for d1t0jb_:

Sequence, based on SEQRES records:

>d1t0jb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
ffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtad
islakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhpaql
sktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqesfdvilde
nqledacehladyleaywkathppssnlpnpllsrt

Sequence, based on observed residues (ATOM records):

>d1t0jb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
ftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislaka
iiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvkiss
pkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywkath
ppssnrt

Timeline for d1t0jb_:

• d1t0jb_ first appeared in SCOP 1.69
  
• d1t0jb_ appears in SCOP 1.73
  
• d1t0jb_ appears in the current release, SCOPe 2.08