Lineage for d1t0ja_ (1t0j A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796440Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 796441Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
    Uniprot P54288
  8. 796443Domain d1t0ja_: 1t0j A: [106211]
    Other proteins in same PDB: d1t0jb_, d1t0jc_
    complexed with cl

Details for d1t0ja_

PDB Entry: 1t0j (more details), 2 Å

PDB Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
PDB Compounds: (A:) voltage-gated calcium channel subunit beta2a

SCOP Domain Sequences for d1t0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ja_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
ndwwigrlvkegceigfipspvklenmrlqheqrak

SCOP Domain Coordinates for d1t0ja_:

Click to download the PDB-style file with coordinates for d1t0ja_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ja_: