Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries) |
Domain d1t0ja_: 1t0j A: [106211] Other proteins in same PDB: d1t0jb_, d1t0jc_ complexed with cl |
PDB Entry: 1t0j (more details), 2 Å
SCOP Domain Sequences for d1t0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ja_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn ndwwigrlvkegceigfipspvklenmrlqheqrak
Timeline for d1t0ja_: