Lineage for d1t0ja_ (1t0j A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783224Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2783225Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2783227Domain d1t0ja_: 1t0j A: [106211]
    Other proteins in same PDB: d1t0jb_, d1t0jc_
    complexed with cl
    has additional insertions and/or extensions that are not grouped together

Details for d1t0ja_

PDB Entry: 1t0j (more details), 2 Å

PDB Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
PDB Compounds: (A:) voltage-gated calcium channel subunit beta2a

SCOPe Domain Sequences for d1t0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ja_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
ndwwigrlvkegceigfipspvklenmrlqheqrak

SCOPe Domain Coordinates for d1t0ja_:

Click to download the PDB-style file with coordinates for d1t0ja_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ja_: