Lineage for d1t0ib_ (1t0i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856771Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
    Pfam PF03358
  6. 2856785Protein Hypothetical protein Ylr011wp [110473] (1 species)
  7. 2856786Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110474] (1 PDB entry)
    Uniprot Q07923
  8. 2856788Domain d1t0ib_: 1t0i B: [106210]
    complexed with ca, fmn

Details for d1t0ib_

PDB Entry: 1t0i (more details), 2 Å

PDB Description: YLR011wp, a Saccharomyces cerevisiae NA(D)PH-dependent FMN reductase
PDB Compounds: (B:) YLR011wp

SCOPe Domain Sequences for d1t0ib_:

Sequence, based on SEQRES records: (download)

>d1t0ib_ c.23.5.4 (B:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddelip
aqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpalv
vsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilqll
ascie

Sequence, based on observed residues (ATOM records): (download)

>d1t0ib_ c.23.5.4 (B:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvgiimgsvrakrvcpeiaayvkrtienskiqvvdlqqialplyedddelipaqiksvde
yadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpalvvsygghgg
skcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilqllascie

SCOPe Domain Coordinates for d1t0ib_:

Click to download the PDB-style file with coordinates for d1t0ib_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ib_: