![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins) Pfam PF03358 |
![]() | Protein Hypothetical protein Ylr011wp [110473] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110474] (1 PDB entry) Uniprot Q07923 |
![]() | Domain d1t0ia_: 1t0i A: [106209] complexed with ca, fmn |
PDB Entry: 1t0i (more details), 2 Å
SCOPe Domain Sequences for d1t0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mkvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddeli paqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpal vvsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilql lasci
Timeline for d1t0ia_: