Lineage for d1t0ia_ (1t0i A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
Pfam PF03358
Protein Hypothetical protein Ylr011wp [110473] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110474] (1 PDB entry)
Uniprot Q07923
Domain d1t0ia_: 1t0i A: [106209]
complexed with ca, fmn
Details for d1t0ia_
PDB Entry: 1t0i (more details), 2 Å
PDB Description: YLR011wp, a Saccharomyces cerevisiae NA(D)PH-dependent FMN reductase
PDB Compounds: (A:) YLR011wpSCOPe Domain Sequences for d1t0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddeli
paqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpal
vvsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilql
lasci
SCOPe Domain Coordinates for d1t0ia_:
Click to download the PDB-style file with coordinates for d1t0ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t0ia_:
- d1t0ia_ first appeared in SCOP 1.69
- d1t0ia_ appears in SCOPe 2.07
View in 3D
