Lineage for d1t0hb_ (1t0h B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483826Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 483827Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries)
  8. 483828Domain d1t0hb_: 1t0h B: [106208]
    Other proteins in same PDB: d1t0ha_

Details for d1t0hb_

PDB Entry: 1t0h (more details), 1.97 Å

PDB Description: Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a

SCOP Domain Sequences for d1t0hb_:

Sequence, based on SEQRES records: (download)

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
rmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrv
tadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhp
aqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqesfdvi
ldenqledacehladyleaywkathppssnlpnpllsrt

Sequence, based on observed residues (ATOM records): (download)

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
rmpftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadisl
akaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvk
isspkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywk
athpprt

SCOP Domain Coordinates for d1t0hb_:

Click to download the PDB-style file with coordinates for d1t0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0hb_: