Lineage for d1t0hb_ (1t0h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109544Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 2109545Species Norway rat (Rattus norvegicus) [TaxId:10116] [110529] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2109546Domain d1t0hb_: 1t0h B: [106208]
    Other proteins in same PDB: d1t0ha_
    complexed with cl

Details for d1t0hb_

PDB Entry: 1t0h (more details), 1.97 Å

PDB Description: Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
PDB Compounds: (B:) voltage-gated calcium channel subunit beta2a

SCOPe Domain Sequences for d1t0hb_:

Sequence, based on SEQRES records: (download)

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrv
tadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhp
aqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqesfdvi
ldenqledacehladyleaywkathppssnlpnpllsrt

Sequence, based on observed residues (ATOM records): (download)

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rmpftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadisl
akaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvk
isspkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywk
athpprt

SCOPe Domain Coordinates for d1t0hb_:

Click to download the PDB-style file with coordinates for d1t0hb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0hb_: