SCOPe 2.08: Domain d1t0hb_: 1t0h B:

Lineage for d1t0hb_ (1t0h B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110529] (5 PDB entries)
   Uniprot P54287 38-362

8. Domain d1t0hb_: 1t0h B: [106208]
   Other proteins in same PDB: d1t0ha_
   complexed with cl

Details for d1t0hb_

PDB Entry: 1t0h, 1.97 Å

PDB Description: Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a

PDB Compounds: (B:) voltage-gated calcium channel subunit beta2a

SCOPe Domain Sequences for d1t0hb_:

Sequence, based on SEQRES records:

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrv
tadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldadtinhp
aqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqesfdvi
ldenqledacehladyleaywkathppssnlpnpllsrt

Sequence, based on observed residues (ATOM records):

>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rmpftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadisl
akaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvk
isspkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywk
athpprt

Timeline for d1t0hb_:

• d1t0hb_ first appeared in SCOP 1.69
  
• d1t0hb_ appears in SCOPe 2.07