Lineage for d1t0ha_ (1t0h A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557332Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 557333Family b.34.2.1: SH3-domain [50045] (37 proteins)
  6. 557587Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 557588Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
  8. 557589Domain d1t0ha_: 1t0h A: [106207]
    Other proteins in same PDB: d1t0hb_
    complexed with cl

Details for d1t0ha_

PDB Entry: 1t0h (more details), 1.97 Å

PDB Description: Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a

SCOP Domain Sequences for d1t0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus)}
rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
ndwwigrlvkegceigfipspvklenmrlqheqrak

SCOP Domain Coordinates for d1t0ha_:

Click to download the PDB-style file with coordinates for d1t0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ha_: