Lineage for d1t0bh_ (1t0b H:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 482135Family c.23.16.6: ThuA-like (Pfam 06283) [110486] (1 protein)
    overall fold is very similar the class I GAT family but the putative active site has a different structure
  6. 482136Protein GK2113 homologue [110487] (1 species)
  7. 482137Species Bacillus stearothermophilus [TaxId:1422] [110488] (1 PDB entry)
  8. 482145Domain d1t0bh_: 1t0b H: [106206]
    Structural genomics target

Details for d1t0bh_

PDB Entry: 1t0b (more details), 1.7 Å

PDB Description: structure of thua-like protein from bacillus stearothermophilus

SCOP Domain Sequences for d1t0bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0bh_ c.23.16.6 (H:) GK2113 homologue {Bacillus stearothermophilus}
tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
k

SCOP Domain Coordinates for d1t0bh_:

Click to download the PDB-style file with coordinates for d1t0bh_.
(The format of our PDB-style files is described here.)

Timeline for d1t0bh_: