![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.6: ThuA-like [110486] (1 protein) Pfam PF06283; overall fold is very similar the class I GAT family but the putative active site has a different structure |
![]() | Protein GK2113 homologue [110487] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [110488] (1 PDB entry) Uniprot Q5KY38 # 99% sequence identity (Geobacillus kaustophilus TaxID:1462) |
![]() | Domain d1t0be_: 1t0b E: [106203] Structural genomics target complexed with zn |
PDB Entry: 1t0b (more details), 1.7 Å
SCOPe Domain Sequences for d1t0be_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0be_ c.23.16.6 (E:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
Timeline for d1t0be_: