Lineage for d1t09a_ (1t09 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843892Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 843893Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 843894Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 843981Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 843982Species Human (Homo sapiens) [TaxId:9606] [110715] (2 PDB entries)
    Uniprot O75874
  8. 843987Domain d1t09a_: 1t09 A: [106197]

Details for d1t09a_

PDB Entry: 1t09 (more details), 2.7 Å

PDB Description: Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex NADP
PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOP Domain Sequences for d1t09a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t09a_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOP Domain Coordinates for d1t09a_:

Click to download the PDB-style file with coordinates for d1t09a_.
(The format of our PDB-style files is described here.)

Timeline for d1t09a_: