SCOPe 2.08: Domain d1t07a1: 1t07 A:1-79

Lineage for d1t07a1 (1t07 A:1-79)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.279: YggX-like [111147] (1 superfamily)
   beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715)

4. Superfamily d.279.1: YggX-like [111148] (2 families)
   automatically mapped to Pfam PF04362

5. Family d.279.1.1: YggX-like [111149] (2 proteins)
   Pfam PF04362

6. Protein Hypothetical protein PA5148 [111150] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [111151] (1 PDB entry)
   Uniprot Q9HU36

8. Domain d1t07a1: 1t07 A:1-79 [106196]
   Other proteins in same PDB: d1t07a2

Details for d1t07a1

PDB Entry: 1t07, 1.8 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function PA5148 from Pseudomonas aeruginosa

PDB Compounds: (A:) Hypothetical UPF0269 protein PA5148

SCOPe Domain Sequences for d1t07a1:

Sequence; same for both SEQRES and ATOM records:

>d1t07a1 d.279.1.1 (A:1-79) Hypothetical protein PA5148 {Pseudomonas aeruginosa [TaxId: 287]}
msrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmmna
edrkflqqemdkflsgedy

Timeline for d1t07a1:

• d1t07a1 first appeared in SCOP 1.69, called d1t07a_
  
• d1t07a1 appears in SCOPe 2.07