SCOPe 2.06: Domain d1t06a_: 1t06 A:

Lineage for d1t06a_ (1t06 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.17: BC3264-like [109965] (3 proteins)
   Pfam PF06352; DUF1061
   this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain

6. Protein Hypothetical protein BC3264 [109966] (1 species)

7. Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [109967] (1 PDB entry)
   Uniprot Q81BA8

8. Domain d1t06a_: 1t06 A: [106194]

Details for d1t06a_

PDB Entry: 1t06, 1.9 Å

PDB Description: 1.9 A Crystal Structure of a Protein of Unknown Function from Bacillus cereus ATCC 14579

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1t06a_:

Sequence; same for both SEQRES and ATOM records:

>d1t06a_ a.118.1.17 (A:) Hypothetical protein BC3264 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc

Timeline for d1t06a_:

• d1t06a_ first appeared in SCOP 1.69
  
• d1t06a_ appears in SCOPe 2.05
  
• d1t06a_ appears in SCOPe 2.07
  
• d1t06a_ appears in the current release, SCOPe 2.08