Lineage for d1t06a_ (1t06 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006803Family a.118.1.17: BC3264-like [109965] (3 protein domains)
    Pfam PF06352; DUF1061
  6. 2006804Protein Hypothetical protein BC3264 [109966] (1 species)
  7. 2006805Species Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId:226900] [109967] (1 PDB entry)
    Uniprot Q81BA8
  8. 2006806Domain d1t06a_: 1t06 A: [106194]

Details for d1t06a_

PDB Entry: 1t06 (more details), 1.9 Å

PDB Description: 1.9 A Crystal Structure of a Protein of Unknown Function from Bacillus cereus ATCC 14579
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1t06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t06a_ a.118.1.17 (A:) Hypothetical protein BC3264 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc

SCOPe Domain Coordinates for d1t06a_:

Click to download the PDB-style file with coordinates for d1t06a_.
(The format of our PDB-style files is described here.)

Timeline for d1t06a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t06b_