Lineage for d1t02b2 (1t02 B:4-110,B:221-374)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004881Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 3004882Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 3004883Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 3004884Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 3004922Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 3004940Domain d1t02b2: 1t02 B:4-110,B:221-374 [106193]
    Other proteins in same PDB: d1t02a1, d1t02b1
    complexed with lva, so4

Details for d1t02b2

PDB Entry: 1t02 (more details), 2.6 Å

PDB Description: Crystal structure of a Statin bound to class II HMG-CoA reductase
PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d1t02b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t02b2 d.179.1.1 (B:4-110,B:221-374) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritpq
qletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveagah
ayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqa
laeiavavglaqnlgamralat

SCOPe Domain Coordinates for d1t02b2:

Click to download the PDB-style file with coordinates for d1t02b2.
(The format of our PDB-style files is described here.)

Timeline for d1t02b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t02b1