Lineage for d1t02b1 (1t02 B:111-220)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
    Uniprot P13702 4-377
  8. Domain d1t02b1: 1t02 B:111-220 [106192]
    Other proteins in same PDB: d1t02a2, d1t02b2
    complexed with lva, so4

Details for d1t02b1

PDB Entry: 1t02 (more details), 2.6 Å

PDB Description: Crystal structure of a Statin bound to class II HMG-CoA reductase
PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d1t02b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t02b1 d.58.20.1 (B:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOPe Domain Coordinates for d1t02b1 are not available.

Timeline for d1t02b1:

Domains from same chain:
(mouse over for more information)
d1t02b2
Domains from other chains:
(mouse over for more information)
d1t02a1, d1t02a2