SCOP 1.73: Domain d1t02a1: 1t02 A:111-220

Lineage for d1t02a1 (1t02 A:111-220)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (5 PDB entries)

8. Domain d1t02a1: 1t02 A:111-220 [106190]
   Other proteins in same PDB: d1t02a2, d1t02b2

Details for d1t02a1

PDB Entry: 1t02, 2.6 Å

PDB Description: Crystal structure of a Statin bound to class II HMG-CoA reductase

PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOP Domain Sequences for d1t02a1:

Sequence; same for both SEQRES and ATOM records:

>d1t02a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d1t02a1:

• d1t02a1 first appeared in SCOP 1.69
  
• d1t02a1 appears in SCOP 1.71
  
• d1t02a1 appears in SCOP 1.75
  
• d1t02a1 appears in the current release, SCOPe 2.08