Lineage for d1t02a1 (1t02 A:111-220)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505142Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 505143Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 505144Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 505182Species Pseudomonas mevalonii [TaxId:32044] [55039] (5 PDB entries)
  8. 505185Domain d1t02a1: 1t02 A:111-220 [106190]
    Other proteins in same PDB: d1t02a2, d1t02b2

Details for d1t02a1

PDB Entry: 1t02 (more details), 2.6 Å

PDB Description: Crystal structure of a Statin bound to class II HMG-CoA reductase

SCOP Domain Sequences for d1t02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t02a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOP Domain Coordinates for d1t02a1:

Click to download the PDB-style file with coordinates for d1t02a1.
(The format of our PDB-style files is described here.)

Timeline for d1t02a1:

Domains from same chain:
(mouse over for more information)
d1t02a2
Domains from other chains:
(mouse over for more information)
d1t02b1, d1t02b2