Lineage for d1t01a2 (1t01 A:126-252)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) 
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
possible duplication: contains several domains of this fold
The listed PDB entries contain different large fragments but not the whole proteinsProtein Vinculin [47224] (2 species) Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries) 
Domain d1t01a2: 1t01 A:126-252 [106189]
complexed with Talin 1 fragment (SQ P26039 605-628), chain B
Details for d1t01a2
PDB Entry: 1t01 (more details), 2.06 Å
PDB Description: Vinculin complexed with the VBS1 helix from talin
SCOP Domain Sequences for d1t01a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t01a2 a.24.9.1 (A:126-252) Vinculin {Chicken (Gallus gallus)}
fdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthq
ehrvmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsaeineii
rvlqlts
SCOP Domain Coordinates for d1t01a2:
Click to download the PDB-style file with coordinates for d1t01a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t01a2:
- d1t01a2 first appeared in SCOP 1.69
- d1t01a2 appears in SCOP 1.73
- d1t01a2 appears in the current release, SCOPe 2.08
View in 3D
