SCOPe 2.06: Domain d1t01a1: 1t01 A:1-125

Lineage for d1t01a1 (1t01 A:1-125)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
   Uniprot P12003

8. Domain d1t01a1: 1t01 A:1-125 [106188]
   Other proteins in same PDB: d1t01a3
   complexed with Talin 1 fragment (Uniprot P26039 605-628), chain B

Details for d1t01a1

PDB Entry: 1t01, 2.06 Å

PDB Description: Vinculin complexed with the VBS1 helix from talin

PDB Compounds: (A:) unnamed protein product

SCOPe Domain Sequences for d1t01a1:

Sequence; same for both SEQRES and ATOM records:

>d1t01a1 a.24.9.1 (A:1-125) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgke
tvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgts
dlllt

Timeline for d1t01a1:

• d1t01a1 first appeared in SCOP 1.69
  
• d1t01a1 appears in SCOPe 2.05
  
• d1t01a1 appears in SCOPe 2.07
  
• d1t01a1 appears in the current release, SCOPe 2.08