![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein Vinculin [47224] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries) Uniprot P12003 |
![]() | Domain d1t01a1: 1t01 A:1-125 [106188] Other proteins in same PDB: d1t01a3 complexed with Talin 1 fragment (Uniprot P26039 605-628), chain B |
PDB Entry: 1t01 (more details), 2.06 Å
SCOPe Domain Sequences for d1t01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t01a1 a.24.9.1 (A:1-125) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]} mpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgke tvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgts dlllt
Timeline for d1t01a1: