Lineage for d1szpf1 (1szp F:81-144)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444351Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 444352Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 444353Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)
  7. 444358Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (1 PDB entry)
  8. 444364Domain d1szpf1: 1szp F:81-144 [106186]
    Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2

Details for d1szpf1

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament

SCOP Domain Sequences for d1szpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szpf1 a.60.4.1 (F:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv
pmgf

SCOP Domain Coordinates for d1szpf1:

Click to download the PDB-style file with coordinates for d1szpf1.
(The format of our PDB-style files is described here.)

Timeline for d1szpf1: