Lineage for d1szpe2 (1szp E:145-395)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2477843Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2477844Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110554] (2 PDB entries)
    Uniprot P25454 81-395
  8. 2477850Domain d1szpe2: 1szp E:145-395 [106185]
    Other proteins in same PDB: d1szpa1, d1szpb1, d1szpc1, d1szpd1, d1szpe1, d1szpf1
    complexed with so4

Details for d1szpe2

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament
PDB Compounds: (E:) DNA repair protein rad51

SCOPe Domain Sequences for d1szpe2:

Sequence, based on SEQRES records: (download)

>d1szpe2 c.37.1.11 (E:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgvavvvt
nqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclpeaecv
faiyedgvgdp

Sequence, based on observed residues (ATOM records): (download)

>d1szpe2 c.37.1.11 (E:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrtdfelsarqmhlakfmralqrladqfgvavvvtnqvg
gnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp

SCOPe Domain Coordinates for d1szpe2:

Click to download the PDB-style file with coordinates for d1szpe2.
(The format of our PDB-style files is described here.)

Timeline for d1szpe2: