Lineage for d1szpe2 (1szp E:145-395)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 485060Protein DNA repair protein Rad51, catalytic domain [82412] (4 species)
  7. 485071Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110554] (1 PDB entry)
  8. 485076Domain d1szpe2: 1szp E:145-395 [106185]
    Other proteins in same PDB: d1szpa1, d1szpb1, d1szpc1, d1szpd1, d1szpe1, d1szpf1

Details for d1szpe2

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament

SCOP Domain Sequences for d1szpe2:

Sequence, based on SEQRES records: (download)

>d1szpe2 c.37.1.11 (E:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae)}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgvavvvt
nqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclpeaecv
faiyedgvgdp

Sequence, based on observed residues (ATOM records): (download)

>d1szpe2 c.37.1.11 (E:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae)}
vtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqi
pldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrllda
aaqmmsesrfslivvdsvmalyrtdfelsarqmhlakfmralqrladqfgvavvvtnqvg
gnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp

SCOP Domain Coordinates for d1szpe2:

Click to download the PDB-style file with coordinates for d1szpe2.
(The format of our PDB-style files is described here.)

Timeline for d1szpe2: