Lineage for d1szpd1 (1szp D:81-144)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642970Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 642971Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 642972Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)
  7. 642983Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (1 PDB entry)
  8. 642987Domain d1szpd1: 1szp D:81-144 [106182]
    Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2

Details for d1szpd1

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament
PDB Compounds: (D:) DNA repair protein rad51

SCOP Domain Sequences for d1szpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szpd1 a.60.4.1 (D:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv
pmgf

SCOP Domain Coordinates for d1szpd1:

Click to download the PDB-style file with coordinates for d1szpd1.
(The format of our PDB-style files is described here.)

Timeline for d1szpd1: