SCOP 1.73: Domain d1szpa1: 1szp A:81-144

Lineage for d1szpa1 (1szp A:81-144)

Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds)
Fold a.60: SAM domain-like [47768] (15 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families)
contains one classic and one pseudo HhH motifs
Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (1 PDB entry)
Domain d1szpa1: 1szp A:81-144 [106176]
Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2

Details for d1szpa1

PDB Entry: 1szp (more details), 3.25 Å

PDB Description: a crystal structure of the rad51 filament

PDB Compounds: (A:) DNA repair protein rad51

SCOP Domain Sequences for d1szpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv
pmgf

SCOP Domain Coordinates for d1szpa1:

Click to download the PDB-style file with coordinates for d1szpa1.
(The format of our PDB-style files is described here.)

Timeline for d1szpa1: