![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
![]() | Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (1 PDB entry) |
![]() | Domain d1szpa1: 1szp A:81-144 [106176] Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2 |
PDB Entry: 1szp (more details), 3.25 Å
SCOP Domain Sequences for d1szpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv pmgf
Timeline for d1szpa1: