Lineage for d1szol_ (1szo L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099559Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 2099560Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. 2099572Domain d1szol_: 1szo L: [106175]
    complexed with ca, cax; mutant

Details for d1szol_

PDB Entry: 1szo (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of the 6-Oxo Camphor Hydrolase His122Ala Mutant Bound to Its Natural Product (2S,4S)-alpha-Campholinic Acid
PDB Compounds: (L:) 6-oxocamphor hydrolase

SCOPe Domain Sequences for d1szol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szol_ c.14.1.3 (L:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
atpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvv
iltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnape
ipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldarta
ldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahe
alaaidlg

SCOPe Domain Coordinates for d1szol_:

Click to download the PDB-style file with coordinates for d1szol_.
(The format of our PDB-style files is described here.)

Timeline for d1szol_: